PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C022765P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 261aa    MW: 29351.4 Da    PI: 6.5325
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C022765P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37.3e-331872155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt +LH+rFv+av++LGG+ekAtPk++l+lm++kgLtl+h+kSHLQkYRl
  MELO3C022765P1 18 KPRLRWTADLHDRFVDAVTKLGGPEKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 72
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.6091575IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-321575IPR009057Homeodomain-like
SuperFamilySSF466895.38E-161875IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-241872IPR006447Myb domain, plants
PfamPF002497.4E-92071IPR001005SANT/Myb domain
PfamPF143793.0E-19105152IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MERNYPYENG VMMTRDPKPR LRWTADLHDR FVDAVTKLGG PEKATPKSVL RLMGLKGLTL  60
YHLKSHLQKY RLGLQTRKQN MAEQRNESSG TLSNFSGVEE DDRGMQIAEA LKSHVEVQKT  120
ILEQLEVQNK LQMRIEAQGK YLQDILENAQ KSLALAINSN LGNLESTEMQ LINFDAALSD  180
QIEKFKKQEI RGNIANLNDV CKKTADSLIQ ICKVEAAEGD TNEFNVEKNM INFDLNSKGG  240
YDYSANGAEI LEAKVIPCSR *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818290.0LN681829.1 Cucumis melo genomic scaffold, anchoredscaffold00054.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008460438.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK52e-47APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0A0LCI10.0A0A0A0LCI1_CUCSA; Uncharacterized protein
STRINGPOPTR_0001s01560.13e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.17e-70G2-like family protein